PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_802_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 1018aa    MW: 114037 Da    PI: 4.8017
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_802_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding431e-13853248
                                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                        g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  cra_locus_802_iso_2_len_3573_ver_3  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                                        78*****************************.************986 PP

2Myb_DNA-binding32.71.7e-1060103248
                                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                           WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
  cra_locus_802_iso_2_len_3573_ver_3  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                                         68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
CDDcd001673.72E-121053No hitNo description
PfamPF139215.0E-131070No hitNo description
SuperFamilySSF466897.55E-2133107IPR009057Homeodomain-like
CDDcd116592.09E-3055106No hitNo description
Gene3DG3DSA:1.10.10.603.6E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118311.3E-55406647IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1018 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACAKD ENYEPGDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARAXVSQ HKRKESKKES QGEAAQEARR  180
LASLQKRREL KAAGIDIRHR KRKRKGIDYN AEIPFEKRPP PGFYDVTDED HAVEQPKFPT  240
TIEELEGERR VDKEARLGKQ DIARNKIAQR QDAPSAILQA NKLNDPETVR KRSKLNLPAP  300
QIPDHELEAI AKIGIASDIM GSEDLTEGNA ATRALLASYA QTPMQGMTPL RTPQRTPAGK  360
QDAIMMEAEN QRRLTQSQTP LLGGDNPMLH PSDFSGVTPK KKEIQTPNPL LTPSSTPGPT  420
GLTPRIGMTP SGDAYSFGMT PKGTPLRDEL HINEDMDMHH SGNLGGPDSK KELLSGLRNL  480
PQPKNEYQIV MPAPPEDNEE SEEKIEEDMS DRLAREKAEE EARQQALLRK RSKVLQRELP  540
RPPAASVDLI RNSLLRADED KSTIVPPTLI EQADEMIRKE LLSLLEHDNV KYPLDEKAEK  600
EKKKGVKRKS TTVPVIEDFE ENEVKEADNL IKEEAYFLRL AMGHEREFFD DFVEAHRTCL  660
SDIMYFPTRN SYGLSSVAGN MEKLTALQSE FENVKKKVED DDKKAQRLEA KIKVLTKGYE  720
SRAEKLWNQI QATCDQMDTA STELECFQAL QKQEQLAAST RINYIWEEVQ KQKELERTLQ  780
ARYGNLTAEK ERTQQLIQHY RIQEHAALCR ALELAEAEKA AAAAAAAATN ECSANADSAL  840
PDEKTLPVDP ASEELPSHGT DTPHDQEVSR TPKLDIDESK PEPPSIDVAV TDNSEGTNSP  900
KDYGKPPVED PTDPTASSSP EPDVPEMVDE QKNTKDEEIV NEGNDTKAGN ADGGDDMMVD  960
EPKVVEENNS SEETTATPEN APQGPTDDDG NAQKDVXWII PCSGFGVAMK LSASGQVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W3e-9232242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDIRHRKRKRK
2199204RKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084262.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A068TV990.0A0A068TV99_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000299530.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61392431